Teriparatide Cas : 52232-67-4
<
>
Teriparatide Cas : 52232-67-4
Teriparatide Cas : 52232-67-4
Teriparatide Cas : 52232-67-4

Teriparatide Cas : 52232-67-4

gsk@nj-gsk.com jack@nj-gsk.com

Product Description

Name Teriparatide
Synonyms Teriparatide
TERIPARATIDE
PTH (HUMAN, 1-34)
PTH (1-34) (HUMAN)
Teriparatide acetate
PARATHYROID HORMONE (HUMAN, 1-34)
PARATHYROID HORMONE (1-34), HUMAN
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS 52232-67-4
EINECS 640-978-1

52232-67-4 - Physico-chemical Properties
Molecular Formula C172H278N52O47S2
Molar Mass 3890.49792
Melting Point >205oC (dec.)
Solubility DMSO (Slightly), Water (Slightly)
Appearance powder
Color White to Off-White
Storage Condition −20°C

icon png
“Strength builds the foundation, and excellent services reach all over the world.”

create win-win situation with customers

We have cooperated with experienced shipping forwarders for many years, they arrange the shipment. No matter by express, by air or by sea, we will track the course of the goods all the way, to make sure goods arrive at you on time and in good condition.

GET A QUOTE

Related Products

Nicotinamide adenine dinucleotide NAD+ CAS: 53-84-9

Nicotinamide adenine dinucleotide NAD+ CAS: 53-84-9

Physical and Chemical Properties White powder, easily hygroscopic, acidic in aqueous solution. The solid is stable under dry conditions, and the neutral or weakly acidic aqueous solution of this product can be stored at room temperature for 7 days. It will d ...

Methylene Blue CAS 61-73-4

Methylene Blue CAS 61-73-4

Purpose: Alkaline lake blue BB is mainly used for dyeing cotton, acrylic fiber, linen, and silk, with poor fastness and a sun fastness of 2-3 levels. It is also used for paper dyeing, bamboo and wood coloring, as well as manufacturing ink and color lakes. It ...

β-Nicotinamide mononucleotide CAS: 1094-61-7

β-Nicotinamide mononucleotide CAS: 1094-61-7

Basic Information: Product Name: β-Nicotinamide Mononucleotide CAS Number: 1094-61-7 Chinese Alias: β-Nicotinamide Ribonucleotide Phosphate Molecular Formula: C11H15N2O8P Molecular Weight: 334.22 English Name: β-Nicotinamide Mononucleotide EINECS: 214-136-5 De ...

5-Bromo-1-pentene Cas : 1119-51-3

5-Bromo-1-pentene Cas : 1119-51-3

Name 5-Bromo-1-pentene Synonyms 5-b 5-bromo-1-penten 5-Bromopent-1-ene 4-Pentenylbromide 5-Bromo-1-pentene 5-bromo-2-pentene 3-Pentenylbromide ...

	4-Chlorotoluene Cas : 106-43-4

4-Chlorotoluene Cas : 106-43-4

Name 4-Chlorotoluene Synonyms PCT 4-Chlortoluol 4-Chlorotoluene 4-CHLOROTOLUENE p-Chlorotoluene 4-chloro toluene p-tolyl chloride 4-Methylpheny ...

Calcium 2-oxoglutarate CAS: 402726-78-7

Calcium 2-oxoglutarate CAS: 402726-78-7

Calcium 2-oxoglutarate (AKG) is an intermediate metabolite of the tricarboxylic acid cycle, participating in the synthesis of amino acids, vitamins, and organic acids, as well as energy metabolism. It can be used as a dietary supplement with broad application ...

Urolithin B CAS: 1139-83-9

Urolithin B CAS: 1139-83-9

Urolithin B is a novel bioactive compound produced by gut microbiota metabolism of linoleic acid. It has strong antioxidant properties that can improve health. Additionally, Urolithin B plays an important role in human health maintenance and significantly cont ...

1-(methylsulfonyl)spiro[indoline-3,4'-piperidine] CAS: 178261-41-1

1-(methylsulfonyl)spiro[indoline-3,4'-piperidine] CAS: 178261-41-1

Chinese name: MK677 intermediate Chinese synonyms: MK677 intermediate; 1-(methanesulfonyl)spiro[dihydroindole-3,4'-piperidine]; 1-(methanesulfonyl)spiro[indoline-3,4'-piperidine] English name: 1-(methanesulfonyl)spiro[indoline-3,4'-piperidine] E ...

CAS: 75350-40-2

CAS: 75350-40-2

Chinese name: Magnesium Acetyltaurate Chinese synonyms: Magnesium Acetyltaurate; Magnesium Acetyloxytaurate English name: Magnesium Acetyltaurate CAS number: 75350-40-2 Molecular formula: C4H11MgNO4S Molecular weight: 193.5 EINECS ...

4-(4-(cyclopentyloxy)quinolin-2-yl)benzene-1,2-diol CAS: 1353224-53-9

4-(4-(cyclopentyloxy)quinolin-2-yl)benzene-1,2-diol CAS: 1353224-53-9

detailed information Chinese name: CMS-121; CMS121 English name: 4- (4- (cyclopentyloxy) quinolin-2-yl) benzene-1,2-diol;  CMS-121;  1,2-Benzenediol,4-[4-(cyclopentyloxy)-2-quinolinyl]-;  4-cyclopentyloxy-2-(3,4-dihydroxyphenyl)quinoline; ...

5-amino-1MQ 5-Amino-1-mq chloride CAS: 42464-96-0

5-amino-1MQ 5-Amino-1-mq chloride CAS: 42464-96-0

5-Amino-1-methylquinoline chloride is an enzyme that is overexpressed during skeletal muscle aging, associated with repairing NAD+ pathway damage, dysregulated sirtuin1 activity, and increased muscle stem cell senescence. It promotes myoblast differentiation i ...

4H-1-Benzopyran-4-one,5,7-dihydroxy-2-(4-methoxyphenyl)- : 480-44-4

4H-1-Benzopyran-4-one,5,7-dihydroxy-2-(4-methoxyphenyl)- : 480-44-4

Basic information Product name: Acacia extract; 5,7-Dihydroxy-4 '- methoxyflavone CAS NO: 480-44-4 Chinese alias: 5,7-Dihydroxy-4' - methoxyflavone; 5,7-dihydroxy-2- (4-methoxyphenyl) -4-benzopyrone Molecular formula: C16H12O5 Molecular weight: 284.26 Englis ...